General Information

  • ID:  hor003036
  • Uniprot ID:  Q1HA20(120-136)
  • Protein name:  Neuromedin-S-17
  • Gene name:  nms
  • Organism:  Bombina orientalis (Oriental fire-bellied toad)
  • Family:  NmU family
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DSSGIVGRPFFLFRPRN
  • Length:  17(120-136)
  • Propeptide:  MRSEKHLPPLPLLLAICCLGTLHPSSGFPQSVPSYMEALDIPESEKLAFCFSQWTALPDQEQIPSFVMDLCSSIYNRMKVNEENNHEIYKRFLFQFSRTKDPSLKTGESQIATAEYTKRDSSGIVGRPFFLFRPRNGRKVSINEH
  • Signal peptide:  MRSEKHLPPLPLLLAICCLGTLHPSSG
  • Modification:  T17 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  stimulates uterine smooth muscle contraction. Synthetic peptide NmS-17 induces calcium mobilization in CHO cells transfected with either human FM-3/GPR66 or FM-4/TGR-1 NmU/NmS receptors.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: FM-3/GPR66 : 0.085 nM; FM-4/TGR-1: 0.231 nM
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8L9P8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q8L9P8-F1.pdbhor003036_AF2.pdbhor003036_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 225079 Formula: C90H137N27O23
Absent amino acids: ACEHKMQTWY Common amino acids: FR
pI: 12.2 Basic residues: 3
Polar residues: 5 Hydrophobic residues: 6
Hydrophobicity: -30.59 Boman Index: -4222
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 62.94
Instability Index: 5390 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16682011
  • Title:  Structural and Functional Analogs of the Novel Mammalian Neuropeptide, Neuromedin S (NmS), in the Dermal Venoms of Eurasian Bombinid Toads